meraki outdoor ap models

{ With increased mobility and an explosion of IoT devices, expectations for network security and speed have never been higher. { Cisco DNA Center is a complete software-based network automation and assurance solution. "useCountToKudo" : "false", { { For indoor APs such as the MR46E with six ports, all six ports should have connections (see above question). LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, } If, for example, there is an MR86 with two ANT-25 patch antennas connected, do not attempt to aim each antenna in different directions in order to increase the coverage area. { } "actions" : [ ] // -->, Which Indoor Models match the Outdoor Models. { { ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_4","componentSelector":"#threadeddetaildisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":195983,"confimationText":"You have other message editors open and your data inside of them might be lost. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", { "actions" : [ { ] "actions" : [ "actions" : [ { } { "event" : "MessagesWidgetEditAnswerForm", "componentId" : "forums.widget.message-view", { } url: '/plugins/custom/cisco/meraki/profile-card?tid=1532625574552538565', "actions" : [ "selector" : "#kudosButtonV2_0", { } }, }, ], "kudosable" : "true", "context" : "envParam:entity", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], Capacity for smarter spaces Create a custom splash page for guest WiFi in seconds. "parameters" : { "selector" : "#messageview_4", "event" : "editProductMessage", "includeRepliesModerationState" : "true", } "action" : "rerender" }, ] { Meraki's mesh networking functionality is automatic, self-healing and available on all Access Points. "disallowZeroCount" : "false", "actions" : [ ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); } ] "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" "disallowZeroCount" : "false", "parameters" : { } LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_3708312fa6ee0_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/wireless-lan/message-id/26543&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:viewOrderSpec", if ($(this).parents('.lia-component-users-widget-menu').length > 0) { }, "disableLabelLinks" : "false", "actions" : [ }, } ","messageActionsSelector":"#messageActions_6","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_6","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); { }, { In the example case of using a pair of ANT-25 patch antennas with different orientation, a 2x2:2 AP will end up sending the two 2.4GHz streams in one direction and the two 5GHz streams in another direction. "actions" : [ "disableLinks" : "false", "showCountOnly" : "false", $('.cmp-header__search-toggle').each(function() { } "action" : "rerender" { ] LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Show Which Indoor Models match the Outdoor Models post option menu. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/wireless-lan/message-id/26543","ajaxErrorEventName":"LITHIUM:ajaxError","token":"alT5sKTKNGNXYaD6q-ZWCOwNucm6h-S2ifhnw29FszM. "selector" : "#messageview_9", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_8","messageId":196115,"messageActionsId":"messageActions_8"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "eventActions" : [ Wi-Fi 6 with a weather-resistant casing for outdoor deployments, Available in Wi-Fi 6/6E ready or Cisco Ultra-Reliable Wireless Backhaul, Built-in security plus resilient wireless mesh capabilities designed to integrate with your hardware, 802.11ac Wi-Fi for industrial, outdoor environments, Wi-Fi 5 with four radios designed for large enterprise organizations, Wi-Fi 5 with three radios for midsized to large enterprises requiring mission-critical traffic, Wi-Fi 5 with three radios designed for midsized to large enterprises requiring advanced features, Wi-Fi 5 for superior performance and enhanced range in the small business workplace, Wi-Fi 5 for small business workplaces that need a highly secure, reliable wireless connection. MR20: MR36: MR36H: MR44: MR46: MR46E: MR56: MR57: Hardware. "action" : "pulsate" ] { ;(function($){ }, ] "componentId" : "forums.widget.message-view", ', 'ajax'); "context" : "envParam:feedbackData", }, } { "action" : "rerender" }, { It is still important however to make sure the whole unit (AP + directly attached omni antennas) is properly grounded via the chassis of the AP. "selector" : "#kudosButtonV2_8", } "disableKudosForAnonUser" : "false", { "actions" : [ { "entity" : "195966", "}); { Which Antennas are Supported with Which Models of Access Points? In addition, the indoor smart antennas use RP-TNC connectors, while the outdoor antennas use N connectors. If a third-party antenna is used, it is the customers responsibility to plan accordingly and ensure the deployment is operating within the proper EIRP limits for their regulatory domain. }, "truncateBodyRetainsHtml" : "false", Both are widely supported by different antenna manufacturers. LITHIUM.Placeholder(); "event" : "deleteMessage", }, { "event" : "deleteMessage", "truncateBodyRetainsHtml" : "false", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ Current outdoor antennas do not include this self-identification capability. "context" : "", "action" : "rerender" "initiatorBinding" : true, { ] "quiltName" : "ForumMessage", ], { "event" : "ProductAnswerComment", "actions" : [ You are about to leave the US Meraki site Meraki cloud-managed wireless helps make nailing sustainability a snap. { "eventActions" : [ "action" : "pulsate" "action" : "rerender" "context" : "", } "actions" : [ { Get the network of the future today with these flexible access points. } Looking for other types of wireless products? } } "event" : "unapproveMessage", }); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "removeMessageUserEmailSubscription", When working with RF this energy loss is in the form of heat and gives rise to the term thermal impedance, basically a measure of heat loss in degrees Celsius per watt. "event" : "AcceptSolutionAction", { "event" : "ProductAnswerComment", { "componentId" : "kudos.widget.button", "componentId" : "kudos.widget.button", "actions" : [ ","type":"POST","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/wireless-lan/message-id/26543&t:cp=recommendations/contributions/page"}, 'lazyload'); I bet most people in the community learned it by reading the documentation. We Recommended: Bestseller No. ] "actions" : [ "kudosable" : "true", Are you sure you want to proceed? "action" : "rerender" This also gives a certain amount of directionality to the antenna, the second primary property mentioned above. Patch and sector antennas simply focus the RF energy in a particular direction. } "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'k539F7ykV0Y00ANM6ixdgf4VUa6aybGXuvt9Fsrt3CE. ] } "actions" : [ }, "actions" : [ "context" : "", "action" : "rerender" } "action" : "rerender" "context" : "", { { "context" : "envParam:quiltName,message", Featured Cisco products Wi-Fi 6/6E Cisco Catalyst 9100 Access Points Get the network of the future today with these flexible access points. It is required to cover all unused connectors on an outdoor AP to prevent damage that would void the unit's warranty. "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/wireless-lan/message-id/26543&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RkdkYRC14yCSpQyQuUV4U3hmOHQavQO_bJ4nlmPET1k. }); } "action" : "rerender" "initiatorBinding" : true, "actions" : [ }, "}); )*safari/i.test(navigator.userAgent)) { $('.cmp-header__search-container .autocomplete-post-container').removeClass('lia-js-hidden').prependTo($('.cmp-header__search-container .lia-autocomplete-footer:first')); Actual throughput will vary dependent on distance, environmental conditions, number of clients, and client capabilities. LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'WJzdkPb8STRLIY1w3TqnVbynzbi4-rTNEQnrTIR8heM. }); "context" : "lia-deleted-state", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '68O8dPYaHzcNRGFxODMN9XD20dtUQbHaiy_LH-FZRFE. "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "}); { { "displaySubject" : "true" "action" : "rerender" "actions" : [ "context" : "", "useTruncatedSubject" : "true", "action" : "pulsate" "context" : "envParam:selectedMessage", "context" : "envParam:selectedMessage", { }, ] }, } }, } }); Are there more than one icon/button? // Detect safari =(, it does not submit the form for some reason { "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); View Meraki wireless Cisco DNA Software for Wireless ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); The dBi value expresses the amount of gain an antenna has with respect to 0 dBi.

Battery Terminal Removal Tool, Orvis Carry It All Rod And Reel Case, Water Industry In Thailand, How To Adjust School Backpack Straps, Kwikset Lever Door Handle Extender, Baby Trend Expedition Race Tec Jogger Stroller Manual,